PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK26157.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family NAC
Protein Properties Length: 295aa    MW: 33987.4 Da    PI: 6.5147
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK26157.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.71.7e-5191331128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100
                lppGfrFhPtdeelv++yL++k+++ ++ +  +ike+d+yk++Pw+Lp+++  +ekewyfFs+rd+ky++g+r+nra+ +gyWkatg dk++ +   +  
  PK26157.1   9 LPPGFRFHPTDEELVNHYLCRKCSSLPIAV-PIIKEIDLYKFDPWQLPEMALYGEKEWYFFSPRDRKYPNGSRPNRAAGTGYWKATGADKPIGK--PKPL 105
                79*************************999.88***************7666789*************************************98..789* PP

        NAM 101 glkktLvfykgrapkgektdWvmheyrl 128
                g+kk Lvfy g+apkg kt+W+mheyrl
  PK26157.1 106 GIKKALVFYAGKAPKGIKTNWIMHEYRL 133
                **************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.06E-623159IPR003441NAC domain
PROSITE profilePS5100560.0899159IPR003441NAC domain
PfamPF023654.4E-2710133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MTSTGELILP PGFRFHPTDE ELVNHYLCRK CSSLPIAVPI IKEIDLYKFD PWQLPEMALY  60
GEKEWYFFSP RDRKYPNGSR PNRAAGTGYW KATGADKPIG KPKPLGIKKA LVFYAGKAPK  120
GIKTNWIMHE YRLANVDRSA GKKNNSRLDD WVLCRIYNKK GSIEKNYPAT NQVMKTEEFP  180
EIEDTKPHII PSVLHNDHFY MDTSDSVPKL HTDSSGSEHV LSPEFTCDRE VQSEPKWNTV  240
SDDVLSNAFD FDFNYMDGFS DDPFGSQLQI QYSNPMDRLS PLQDMFSFNF MQKPY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-8031659174Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007048529.11e-155NAC domain transcriptional regulator superfamily protein
SwissprotQ390131e-129NAC2_ARATH; NAC domain-containing protein 2
TrEMBLA0A061DKX71e-155A0A061DKX7_THECC; NAC domain transcriptional regulator superfamily protein
STRINGPOPTR_0007s04780.11e-152(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF125834108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-119NAC family protein